PNC27 -10 vials

Category: Peptides

Description
Reviews (0)

Biological Activity
Purity & Documentation
References
Customer Review

Description

PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research^[1]^[2]^[3].

In Vitro

PNC-27 (50 μg/mL; 0-3 h) induces cancer cell death^[1].
PNC-27 (50 μg/mL; 15 min) binds to cell membrane-bound HDM-2 in A2058 and MCF-7 cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Cytotoxicity Assay^[1]

Cell Line:	MIA-PaCa-2 cells
Concentration:	50 μg/mL
Incubation Time:	0-3 hours
Result:	Induced 100% cell death in 90 min.

In Vivo

PNC-27 (intraperitoneal injection; 40 mg/kg; once daily; 2-3 w) shows anti-leukemia activity in mice^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Mll^PTD/WT/Flt3^ITD/ITD AML mice^[2]
Dosage:	40 mg/kg
Administration:	Intraperitoneal injection; 40 mg/kg; once daily; 2 or 3 weeks
Result:	Reduced AML engraftment and prolonged survival.

Molecular Weight

4031.73

Formula

C₁₈₈H₂₉₃N₅₃O₄₄S

CAS No.

1159861-00-3

Appearance

Solid

Color

White to off-white

Sequence Shortening

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL (24.80 mM)

*“≥” means soluble, but saturation unknown.

Preparing
Stock Solutions

ConcentrationSolventMass	1 mg	5 mg	10 mg

1 mM	0.2480 mL	1.2402 mL	2.4803 mL
5 mM	0.0496 mL	0.2480 mL	0.4961 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.